TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=ZIFL1 PE=2 SV=1
MAEEYAECLLEKNFHEDCSGCKVDQMKRLRRGFPFWELFTVWIIVLCTALPISSLFPFLYFMIDDFNIAKKEEDIGFYAG
FVGCSFMLGRAFTSVAWGLVADRYGRKPVILIGTASVVVFNTLFGLSLNFWMAIITRFCLGSFNGLLGPIKAYAMEIFRD
EYQGLALSAVSTAWGIGLIIGPAIGGFLAQPAKQYPSLFSQDSIFGKFPFFLPCLAISVFAFLVTIVSSRIPETLHNHKF
NDDESYDALKDLSDDPESNKVAERNGKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSPRKYGGLGYSTADVGSV
LAFSGFGLLIFQLSLYSYAERLLGPIIVTRISGSLAMVVLSCYPLIAKLSGLALTVTVTSASVAKSVLGTSAITGLFILQ
NKAVRQDQRGAANGIAMTAMSLFKAIGPAAAGIIFSWSEKRQGAAFLPGTQMVFFILNVVLALGVVLTFKPFLAETQQ