TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q95V80|Q95V80_STRPU Receptor for egg jelly 3 protein OS=Strongylocentrotus purpuratus GN=REJ3 PE=2 SV=1
MEFAAAMRNVVFISFLLNAVFKAAVIAGTETEIICEGQNGVIDCGVDIISISSSVYGRTDTNTCAEDDSNTNCVLDVAPE
LAYCNGQAQCSIEALNLSFGDPCQGVLKYLNVTYICKDSVCEADWVHNNGSCYLFHEERTTWESAREFCLGLGADLVSIH
SANENAFVNDGISGNAWIGITDQESEGVFSTFTDGTPIDFQNFPGTASSHQGEAYDCAFINLTHGQWSWRDCENRYLAVC
KHVSAITSTIHPITTLHTTPSVTTTPAIQEIVPTPFNGTQLQTTTQPSTTINNDEVPSCDATSAITIGSSYLCIELFLLP
DYVSSIDNIFRVNDTVVAMASVLGSFQPLSSEIVWSITNHLSGDSVQYTVYSEDAVLVLFTTTSIFTIEATAVGTDSQDL
AATASAVVLPAIQILCPTHVYASREVRCALLTDSVVTHSNYTFCFDSSEDSCSMANPRSWSLDDIPYELMDRVSVMDGFL
ASFLNHTYSGVGSYMVTAEIFQTLATAVEVNVTVDHECISSLRMVKGHGNTTHPAVFLRASEIAISAHIELDEKCIGPMT
SDFKWWIFTSTVDDDVVIAFEKITHTPQVTIPSGTLPYGIYSLNLKADTHLRTSDEVIGEVKIITWLEIQPSPLVAFIKG
GASRSHGVSSNLTVDGANSYDPDVNLRSSSDLTFLWYCVLVDPDIMYSSLDAALQNTDDACFEGEEIMMNSSSSKVEIIT
SELQANVIMNFWLIVSKDGRTSDSTQQRIQLTPGLLPEIEISCISNCNTYFFTAERLVLHASCSNCDSENEDVVFLWSLE
SDHTSIIGDLSSQTSTGLDQPYLVVKPHTFDSISETGSIIIRVTGYTSNSSSGGYAEFSVKFNAPPTSGSCSVIPIDGYA
LQTDFTVACQGFTDVDDPLTYEMLIYSSVDVVDGDFVGLGEGFQLYEGSESLQDGLYLPVGDGAHDYSILLQVNVIDCFM
ASTSVFLIAAVHPPTIDTGGENGTRELLNMTSSVESNVNSLLAVGDTGQAAQLINALGSILNSIGDEDDDAEDNDEWRDT
RSEIRSSLVDSVAAIPVESMSSLRQSSAALAVITHNKREISTDVQVKAANALSEMTSFLKAESGSYTQSQGTIESAGTIL
VEGLSNIFSAAKETESLPSNNTSQDAQESKAKSNKELTEAAVSAINDIQDAIVAGKIPSEEATIITSPTLSIAVGSISRD
MLSEATFRGSDEDDVDGGLGSFTMPSRDGVLDDTLDSVNGTVISMQMSTLRWNPFSWGAGEESLNPRSVGIQLKADHNIL
QVRNLSDVISVYLPVEEPLSRDPLSVHITKDFSASLLVNHSSMAEDGALHLIVRAENEPMVTLSICTANISINETSCVGN
AMVVRSSNEDLLNTAANFTWSVSAADLSAADGMMISLYDGKDQPVYQHDNITLSIFMHTPQCTFWNEDEQAWGSAGCKGG
PLSNPTKTHCLCNHLTFFGSSLFVPPNKINIFKDAKLFLTFVDNPIVVSFVACVLAGFVLVAVWARRKDKRDARRAAVTV
LEDNDPYHQYLYNVTVVTGFRRGSGTTATVTLTLTGKEGQSDPHVLHDSFSPILDRGSTDSFLLTTAKGLGDIQALRLWH
NNAGSSPNWYVSHCIVHDLESDERYYFICNSWMMVEFGGVGLDNTFHIASSKDLHKFGHLFTAQTVRDLRDGHLWLSVLM
RPKHSNFTCLQRVWCCLSLLMCCMMTSIMFYGIPNDPADQVMDFGTFRITIKEIIIGIQSSLIAFPVNLLIVQIFRHIRP
SLKVRTAAHRENDMVKSKPDIAHSLSSIDLARKEDVESDSADHKVTSTSMSKSFQNEERETLPGHLQSPEKSSHHWVGGG
DSSSTSSKDDNPGNSSASSSTTTLPSRISFNSSMFRQEMDDFVLRSVSAVMKEWGGDKRSKRVEIFGHGGLDKVDQPQSE
AKEDTTSQSIQEDPKQLKEEIDLAECSRDSPDDLKPPQIRGVTHNYYLYSRLLDMVKGLSLADRFYDPEEHKKALSEAQT
IVMTAMKIDTPPTSPDESLLSEDVSLEKIKLKQRIRGLPHACVYIAWLLVFSTVLASSYITMLYGLKYGKQSSIDWLISL
FIATFQSIFITQPIKILFLAVFVSLIFKQIEPEEDFSDDIEELQVANAQETQRALQKRRNTMAHYQPPAASAIHSHLRNK
QLKTRMYSLLWQIAGFLCFFYLLITITYTQRDRQAYWMTRGTKGLFFYHKNKDYHLMNDFRSFLKWADSTLLPGLLSENR
WGAEKQSTLIGGGLRLRQVRVKPSSCETHPLFVDLINDCRALFTPESEDRELYNASWSQPIVNMSALLNSSQTVEEWSLS
NYSPWHFYPDKAVGMWGHATSLPSSGYIWVLGSMYEEAKDSLAEMVDARWLDARTRALFVEWTSYNANTNLFCVVTFLME
TPASGGLLKLPEVQAVRLHRYAANYKLFVILCEILFVVALFFVMYREYVRYKPIGIRKYLSDKWNLLEIAIIVNCIVSAG
LYIYRYVITKQLFKQMRDESVRFVGFRTAATSDNALGYSLAVIIILSCVKFLYLLRLNPRMYLLTSVISDCYHEVIAFTF
LIFILILSFAFPMTIMFGSNLPDYRDITKTALNLFITLPDNFVYEDLKSVQRVLGPLILLLFQFLSCYLFLDLLIAALNE
SMVTIRRHPPPPSENRMLGLLLLSKIFSLLGIPDRFHISLD