TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q97RS4|Q97RS4_STRPN Putative uncharacterized protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_0719 PE=4 SV=1
MLKKWQLKDVILLAFLSIFFGGVFVGSGYVYNILSLLLTPLGLQAFANEILFGLWCMAAPIAAIFVPRVGSATIGEVLAA
LAEVLYGSQFGLGALLSGFVQGLGSEFGFIVTKNRYESWLSLTANSIGITLVSFVYEYIKLGYYAFSLPFVLSLLVVRFI
SVYFFCTILVRAIVKLYHQFATGGKA