TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9A608|Q9A608_CAUCR TonB-dependent receptor OS=Caulobacter crescentus GN=CC_2287 PE=3 SV=1
MNTQFSRRRAWLMAGGATGLALAFAVAGSAQAQTTTTAADDTKVEEVVITGIRAGLENSIALKKQSTSIVEAISAEDIGK
LPDTSIAESLARLPGLTAQRLDGRAQVISIRGLGPDFTSTLLNGREQVSTGDNRGVEFDQYPSEILSGVVVYKTPDAGLI
GQGLSGTADLRTIRPLTYGKRILSANARYEMNSEKKLNPDAKDTGHRFSATYVNQFANDTVGLALAISDISTPTQSKRFN
AWGYPTINAANDRVIGGAKPYIQSNNLERFGAIGVLEYKPNDKVTTSLDVYYSEFQEEQILRGIELPLQWSSATLQPTRT
TTAGLITNGTFSGVKGVMRNDLNTRDTTLKSAGWNLNYLTDNGWSLTTDLSYSSADRTDVIFESYSGTGPNGVGATDTLG
FTTTPGAGTMFASTLDYTDRNQFKLTDPQGWGGGASGGALTQAGFYNTPSITDELTAARFTAKRDLEWGPVKSVEFGLNA
SRREKDKEVHESFLTFGGRIAAGAPTSRAIPQEAIIGVAKLDLIGIKAMLAYDPTYLLKNGFYTLIADANPAVQTRNWSV
REDVQVAYAKFGVDSQVGSIPVTGNFGLQVVRTDQFSKGVAVNPSAPASPTVTDDGAKYTYALPSLNLTFDAGNELYIRV
GAARTLARARMDELRASQSFNQNTSRLTSTDPNNSYFSANGGNPNLRPYIADGVDVAVEKYFGRSAYLSAAVYHKELSNF
VNSNSSSYKDFSDYLFLLSTAQQAQLGTKIGLVSGPDNGDGGYIRGLELSASLQGELLWEPLKSFGLIISGSFTDSKVTL
EKGTNPITIPGLSKTVVNTTFYYEKNGFNARISNRYRGKFLGEVAGLSAARVFRTVDKESVVDAQIGYEFRDGPMNGLSL
LLQANNITNEPFKTYDNNDQRQTIDYQKYGATYMVGVSYRF