TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9AK99|Q9AK99_STRCO Putative integral membrane protein OS=Streptomyces coelicolor GN=SCO1363 PE=4 SV=1
MPVHTSDSARGSRGKGIGLGLALASAVAFGGSGVAAKPLIEAGLDPLHVVWLRVAGAALVMLPLAVRHRALPRRRPALVA
GYGLFAVAGVQACYFAAISRIPVGVALLVEYLAPALVLGWVRFVQRRPVTRAAALGVVLAVGGLACVVEVWSGLGFDALG
LLLALGAACCQVGYFVLSDQGSDAGEEAPDPLGVIAYGLLVGAAVLTIVARPWSMDWSVLAGSAPMDGTPVAAALLLAWI
VLIATVLAYVTGIVAVRRLSPQVAGVVACLEAVIATVLAWVLLGEHLSAPQVVGGIVVLAGAFIAQSSTPAKGSADPVAR
GGPERELSSRGTST