TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9ALL8 TRANSFERRIN BINDING PROTEIN A - Pasteurella multocida.
MLTLVFSVIRRSFMKFKYCVIHQLVLSGSLIFPTLSFADSDSTKTTPNKASYLEEISVVATTVQHIFSSTQSTEQLRKNM
VSNERDLFRYEVGIGVPESGRSGSNGFAIRGVDKDRVAVIVDGIPQAESTISTSARYSTERHNGNINNIEYENVSSLKVQ
KGAASVMYGSGALGGTVEFTTKDIEDFVEPGRHLGFLSKTGYTSKNREYRQVIGVGGKGEHFFGFVQLTKRWGHETINNG
KGTDILGEHQGKPNPLNYYTTSWLTKVGYDINNTHRFTLFLEDRREKKLTEEKTLGLSDAVRFANDQTPYLRYGIEYRYN
GLSWLETVKLFLAKQKIEQRSALQEFDINNRNKLDSTMSFVYLQRQNIARGEFSTSPLYWGPSRHRLSAKFEFRDKFLEN
MNKHFTFRPWQINTFRQQGRNNYTEVFPVKSREFSFSLMDDIKIGELLHLGLGGRWDHYNYKPLLNSQHNINRTQRLPYP
KTSSKFSYQLSLEYQLHPSHQIAYRLSTGFRVPRVEDLYFEDRGKSSSQFLPNPDLQPETALNHEISYRFQNQYAHFSVG
LFRTRYHNFIQEREMTCDKIPYEYNRTYGYCTHNTYVMFVNEPEAVIKGVEVSGALNGSAFGLSDGLTFRLKGSYSKGQN
HDGDPLKSIQPWTVVTGIDYETEGWSVSLSGRYSAAKKAKDAIETEYTHDKKVVKQWPHLSPSYFVVDFTGQVNLSKNVI
LNMGVFNLFNRDYMTWDSAYNLFTRGYTSRSVRANSPGINRFTAPKRNFAASVEIRF