TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9CES4|Q9CES4_LACLA Glutamine ABC transporter ATP-binding protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glnQ PE=3 SV=1
MGINTQIEVTDLHKSFGKNEVLKGITTKFEKGDVVCIIGPSGSGKSTFLRALNGLETATSGDIIIDGFNLTDKNTNLNLV
RQNVGMVFQHFNLFPNMTVMQNITYAPVELKKMSKDDADKKAIQLLETVGLLDKKDAMPEMLSGGQKQRVAIARALAMNP
DVMLFDEPTSALDPEMVGDVLAVMQKLAEEGMTMLIVTHEMGFARKVANRVIFTDGGVILEDGTPEELFDSPKHPRLQDF
LSKVLNA