TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9F241|Q9F241_STEMA Putative membrane fusion protein OS=Stenotrophomonas maltophilia GN=smeD PE=4 SV=1
MLLSRIRPFALSLAIAATVAACGGQPQAPEQGPGDVTVVTLKSETVGLTRELPGRTNAFLVAEVRPQVNGIVAKRLFTEG
GMVKAGEPLYQLDDASYRAQANNARAQLARAEATANAARLSAKRITELAKVDAVSQQDLENAVAAQKQAEADVGAAKASL
DAANVTLGYARITAPISGRIGKSSVTQGALVSAGQANALATVQQLDPIYVDLTQSSAELLQLRRELAAGRLQDNQTLPVS
ILMEDGSTFEHKGTLEFSEVSVDPTTGSFGLRVKVDNPDGLLMPGMYVRAVIGGGVRSDAVLVPMQGIARDPKGDTTAMV
VGKDNKVEVRPVKVSRTVGDKWLVEDGLKAGDKVIVEGLQKIGPGMPVKATEKGDAPAKPAAAAQPAAPAGDAK