TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9F5N7|NORM_BURVI Probable multidrug resistance protein norM (Na(+)/drug antiporter) (Multidrug-efflux transporter) - Burkholderia vietnamiensis.
MSHSGLTRTAAAPPSLSRHAVDTARLAAPLAIAQLSQMAMSVTDTVLLGSLGPDSLAAGGLGANFFFVIVTVLQGVLSSV
SVSVAHARGAQAEHRVPHIYWTGFVLSVLLAIPAVVALSLSEPLLLMFHEPPTLAQHVGEYTGILRFAALGSLIGVGLMR
AFLPAIGAARRLLWVSIGGIGVNAVLNYGLIHGAYGLPRLGFLGSAVATTITIWLTAFALIWLLHGRARFRHFVSAARPK
LPMMGELIGIGWPVAITYGVESTLFLATGLTVGVLGATALAAHQIALNVASVAFMVPLAIGQAANVRVGYWIGAGDPVAA
RHAGFVALGLGVAFMSLSGLVLILAPHAIVGLYLHLDDPANAATVSLAASLLGIAAVFQIVDGMQTVGSGALRGLRDTRI
PMLAATFGYWGIGFPTGYWLAFHAGLGARGLWWGLAAGLASVAVLMAWRFHLKTSSLIAAPR