TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9FBS6|Q9FBS6_STRCO Putative sugar-transporter integral membrane protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO7166 PE=3 SV=1
MSLSTTSRPARAVRDLFATARGRDRLTGLLMTAPAVALFLVMMVVPLVLSGYLSLTDWDGYTAHPAMVGLDHYRALLDDP
EVRQAAWITVLLAVIGTLAVNAVGLALALAISTPGRTNTVLRTVFFYPYVISALIIGFLWSALLSTNGAVNSVLRAAGHA
GLPFLSQPGWALASLIGVVVWSGFGFTLVLYIAGLHTVPASLLEAARIDGAGRWRILRSVTLPMIAPVVTVNVVLTLVTL
LRSYDLVLSLTGGGPAGSTQTAAYLILAQSFQNNALGYGSAQSMVLTLVTGIAALAITFLRRRADERAGA