TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9FBS7|Q9FBS7_STRCO Putative sugar-binding integral membrane transport protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO7165 PE=3 SV=1
MAPATAPNRRPRRPAPAPRTRRRASGTVAGTSLWRLPLLLVSASFMVIPLWLLVVNAFKSEQDIRDSPFGLPLTRLSLRP
LRDAFANPDFDVVRAYGITLLFVLLVNVLSLLVSAPVSYVIARGTTRWHTALLLLFVAGTFVPSQVLLIPVVYVLKYLGL
MGTVPGFVLFETALTLPVSVFLYSAYIRTIPRELDQAASVDGLGRLRTFQLVVLPLMRPMVATAVILHSLSVWNDFANPQ
IILGPGSGLYTVTTGVYAAVGKYSTHYAVVFPNLLLAVAPALAFFAIMQRHIISGLTSGALKG