TCDB is operated by the Saier Lab Bioinformatics Group
>gnl|TC-DB|Q9GKY1 2.A.31.2.5 Anion exchange protein 4
MKLPGQEELEAACACENVPVGQLDSGPSSGPCPDDPSDTGSRELGPPEDPPLFLQLNELLGWPQTLEWREMGRWVLFEEK
LEVDAGRWSAPHVPTLALPSLQNLRSLLAEGLVLLDCPAQNLLELVEQVTRVESLSPELRGQLQALLLQRPQHHTQTTGS
RPCWGPAQSRKAAHNKEAPMQQQCQSPLRQKLPPGAEAGAVLAGELGFLAQPLAAFVRLRDPVWLGPLTEVPLPSRFFCL
LLGPPMLGKGYHELGRAAAVLLSDPHFQWSVRRASNLHDLLTALDAFLEEVTVLPPGRWDPTARIPPPRCLPSRHKRPPL
HLQKVKGLSVPHRTQAEDRHRNGPLAPSPELQRTGRLFGGLVQDVRRKASWYPSDFSDALHPQCVSAVLYIYLATVTNAI
TFGGLLGDATDGAQGVLESLLGTAVAGAAFCLMAGQPLTVLSSTGPVLVFERLLFAFCRDYSLDYLPFRLWVGIWVAVFC
LALVATEASVLVRYFTRFTEEGFCALISLIFIYDAVGKMLNLAHAYPIQRPGSLAYGCLCQFPGPGGNESQWTRPRPQSR
DDLLSVDLGLVNASLLPPHECVQQGGYPRGPGCHTVPDIAFFSLLLFLTSFLFAIALKHMKTSRFFPSVVRKVLSDFSSI
LAILLGCGLDALLGLAMPKLMVPREFKPTLPGRGWLVPPFGANPWWLSVAAALPALLLSILIFMDQQITAVILNRVEYRL
RKGAGFHLDLFCVALLMLLTSVLGLPWYVSATVLSLAHMDSLRRESRACAPGEPHSFLGIREQRLTGLAVFTLTGVSIFL
APVLKFIPMPVLYGIFLYMGVAALSSIQFMKRVQLMLMPAKHQPDLLLLRHVPLSRVHLFTAIQLACLGLLWIIKSTPAA
IIFPLMLLGLVGVRKALEWVFSPQELLWLDELMPEEERNVPEKGLEPGHSFSGSDSEDSELMYQPKAPEINISVN