TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HLP1|Q9HLP1_THEAC Hypothetical membrane protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0186 PE=4 SV=1
MIYMYNENMNNGMPRNFQLTVANAAISRFGLSAYNLVIIWVILQVTGKPALAGLADSMMTFPLMLSIVVGSFVDRMWLKK
ELAISAAVIRVVLLLFILFAIHTGKDLYIAVSIFAATFILGFTSDVIDSVRSSWMKAFLREDQYKAGSSEMSSATMIAQG
VGFILSGIIIALGDIRSFLVLTLIFLISILPILAIRHARYGGTDTIQNYIKEGIKLAIGDGRIREVIIIGLIGNFIVGMA
AIMFISLVQVGFRLPAIYVSMIFGVLVFGIAIGSVAGSKITGNVGRISIAMYAIVGISFFSISLVKNALLAVPPSFIAGM
AMGIENVAVNTSLMRIIPIDMMARIQGAFNTFGIAATAVSSIVGGFLYQSAGRIYSFMIVGVSMILVSALIKFLRNFSSM
IY