TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HM05|Q9HM05_THEAC Gliding motility protein (GldA) related protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0066 PE=3 SV=1
MMNCSIKIDNVSMRYGEKLALDGVTLDIPEGTIYGILGPNGSGKTTLMRIILGLLKQTAGSAIVCGYDSTRDQMKIKEIS
GYVPETPILYESMTPSELFSFIASIRRMDEGTFRRRVDALIDAFGIAEYINEFIGSLSFGNRQKVAIISAILHDPKILIV
DEGINGLDPRSAKLFKSILTDMRDHGKIIVFSTHILEIAESLCDHVAILYNGHIVANGTIADLRNEANAPSQNLEEIFLK
LTNADDIPEVARYLRDEIEH