TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HM06|Q9HM06_THEAC Conserved hypothetical membrane protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0065 PE=4 SV=1
MARSSRVRNKGNYIMRYVNISYGATSFSFIVFSLILVAPSLMEHRIYTLSSVVLLLFVYSLFINISNSLLFFVSVNINHI
LDPLRILPVDFPDHVIAVSWFIYTGSSSLFAVLPAIFLAAFLLGDPYILVIGLIWSIFSVLLGYIIGSSIFVAFGSRISG
KRTRSTNILRNVGRIVFLVFVFAIFEIILYNANIVNGIIPRLPYPYSYFIPIFNIQSTVFFFHGIYMQATGFIISMVYTA
LASFAFIYVNRKAFYRLLEPTARNQSRVKTQMKAEVRSRPFSFFSKDLKISSRKSQNLVLLIMPLFFVFPTIMSEVLYAP
TSKADPIILYNAMVAFVIVTSSFYSILFLVIEGNGISFIKALPLDGNSIIRWKISAPTFIFAVISISTLAAISVKALMGA
AFYIIIIVDMMLYFVSSTVYNMNRLYRKIPDTADTVNFYSFGGQIAFITTFAFTGLIVGSADIFSLFLQDLLRLNAYFFF
LINTVIGIIVLLFMVFRYNIVLLNADRESGQSVHQ