TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9HT70|METN2_PSEAE Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN2 PE=3 SV=1
MIEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEGLRRF
RQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRP
SILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRR
FVFEAERVDEDERHDDFAHVPGLILRLTFRGEATYAPLLGTVARQTGVDYSILSGRIDRIKDTPYGQLTLALVGGDLEAA
MSQLNAADVHVEVLR