TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HWH3|Q9HWH3_PSEAE Probable outer membrane protein OS=Pseudomonas aeruginosa GN=opmD PE=4 SV=1
MKRSYPNLSRLALALAVGTGLAACSVGPDYQRPQSPPPRVASEHLGEFSGERREAPWWSFFDDPQLVRLVDQALARNHDI
REARANLRSARALFDDRWLDQLPQVTSQAGYSRSIEQQLDYDGEPRRRLAESYRAGFDAQWEIDLFGRLGRLSDAALARA
EAADADLRLVRLSIAADTARAYFEIQGYQRRLDVARAQVRSWRDTLELTRSSLQLGSGLPEDVENAQANLLRSEAAIPPL
TTALESARYRLDVLRGEAPGSGAPILDGGAAAPLAKNLPLGDVDRLILQRPDVVSAERQLAASTEDVGAATAELYPRLDL
GGFIGFFALRSGDLGSASRAFELAPSVSWPAFRLGNVRARLRAVEAQSDAALARYQRSLLLAQEDVGNALNQLAEHQRRL
VALFQSATHGANALEIANERYRAGAGSYLAVLENQRALYQIREELAQAETASFVNVIALYKALGWGSGDLAPGAGQLAAG
ETAGANR