TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HWH6|Q9HWH6_PSEAE Uncharacterized protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mexG PE=4 SV=1
MQRFIDNSLESNWLWLTARICLALMFVASGLAKLFDYQASLEEMRAAGLEPAWLFNIATAVTLLAGSALVLLDRKLWLGA
GALAVFLLLTILIVHTFWSKTGVEAKLAMFFALEHIAVIGGLIATAIASAQRQRLRQDVSVAATYQKA