TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HXH5|Q9HXH5_PSEAE Uncharacterized protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) GN=PA3827 PE=1 SV=1
MVKLDRYIGVTVFVAILAVLGVILGLALLFAFIDELNDISASYGIGDALRFIFLTAPRRAYDMLPMAALIGCLVGLGTLA
SNSELTIMRAAGVSLSRIVWAVMKPMLVLMLAGILVGEYVAPWTENIAQSGRALAQGGGDSQSSKRGLWHRQGREYIHIN
AVQPNGVLYGVTRYRFDEQRGLESASFAKRARFETDHWQLEEVTTTLLHPREKRSEVVKLPTERWDAQLSPQLLNTVVME
PEALSISGLWQYIHYLADQGLNNNRYWLAFWTKVLQPLVTAALVLMAISFIFGPLRSVTLGQRIFTGVLVGFVFRIAQDL
LGPSSLVFDFPPLLAVVIPASICALAGVWLLRRAG