TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HY86|Q9HY86_PSEAE Probable Resistance-Nodulation-Cell Division (RND) efflux membrane fusion protein OS=Pseudomonas aeruginosa GN=mexP PE=4 SV=1
MNLRHFIRITATLGVAALIAGCGESAPPGAASAPPSVPVAEVVVRPVTPYAEFTGSLTAVEQVELRPRVAGYIQDVTVPE
GRLVEKGQQLFLIDPRVFKAAQDAARARLREAEAAALLARTEHERAELLYARKVVARERLDSAIASRNASKAQVDAARAA
LDAAQLDLGFTRVTAPIGGRVGHIQVTEGNYVTNGVTALTSIVSVDPLYVYFDVDERTYLQALAPTRGREGEQAPRVKVA
LLTDESYGRSSRLDFLANAADRGTGTVRVRAVVDNPDGQLTPGLFAKVRLETGKPRAQVLVADHSIGTDQGRRYVLVVDE
GNKTQYRPVELGPMVDGLRVVRQGLQPGERIVVKGLVRPDMQITPRLAEIDGTPVDLSKTVGAAQ