TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HY88|Q9HY88_PSEAE Probable outer membrane protein OS=Pseudomonas aeruginosa GN=opmE PE=4 SV=1
MKPYLRSSLSALILLGGCAAVGPDYAPPSASAPASFGAMPAGIDGSGVEIEWWRGFDEPALESLIQRALAANLDIALAGA
RLDEAKALLRENREEFLPRGGPAFDYQARRRGEVETPAGQQRDIETYRGALDASWEIDLFGRVRRSVEAAEAQAGSREAL
LRNVQASVAATVAMSWFQLQGIEAELAVVHDIAGNQRDSLEMVERLVSAGSAHEFDRLRAEALLHNVEAAVPDLERRRAA
TRNALAVLLAEAPQAFSPPVARASGERLTLRTLGVGDPAGLLARRADIAAAERNLAAATARIGVETAGLYPQVEVRGSIG
LVAGNLDALDESGTSFNVLNPVIRWALLDRGRVWARIAASEARAQEALILYDRTVLRALQETDDAFNGYGAAADRLRLRL
LEATANREAARLARERFVQGDGEYLDVLEAERSDYLSRRALSIARTEQRLAVVGIYKALGGGWEACAGARRCGVATDDTS
PGVARQRDSRS