TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9I2M0|Q9I2M0_PSEAE Probable secretion protein OS=Pseudomonas aeruginosa GN=PA1877 PE=4 SV=1
MDSDRDAAALRRQLADPLLAATHPVYRPLLWTLLGCVLLFIGWAAWAQLDEVTRGDGRVVPFSRIQKIQSLEGGILDRLL
VKEGDLVEVGQPLVRLDETRFLTNFQESANQASVLRAAIARLDAEVLGKKSIEFPPDVDPEGPLARSERELFKSRRDKLV
EGTQAIQRQIHLAQSQLDLVRPLVAKRAVSQMEALKLSQDIATLSGKLTELKSTYFQDAYTERAQRKADLSALEPIVQQR
QDQLRRTEILSPVRGRVNTVLINTRGGVIQPGEPIMEVIPVEERLLVEAKIKPRDVAFLVPGMPAKVKITAYDYTIYGDL
KGTLEQISADTIEEDTPHGKESYYQVLIKTDGSQLKRGEEVLPIIPGMVAEVDILSGKRSVLNYLLRPLIKARLY