TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9JJJ0 CALCIUM TRANSPORTING PROTEIN HOMOLOG - Mus musculus (Mouse).
MGWSLPKEKGLILCLWNKFCRWFHRQESWAQSRDEQNLLQQKRIWESPLLLAAKENDVQALSKLLKFEGCEVHQRGAMGE
TALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHMAVINQNVNLVRALLARRASVSARATGSVFTTGPYKPH
YYGEHPLSFAACVGSEGDGRLLIEHGADIRAQGLSGKYEYYNILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQG
LTPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLK
WKRYGRPYFCVLGAIYVLYIICFTMCCVYRPLKPRITNRTNPRDNTLMQQKLLQEAYVTPKDDLRLVGELVSIVGAVIIL
LVEIPDIFRLGVTRFFGQTILGGPFHVIIITYAFMVLVTMVMRLTNVDGEVVPMSFARCWLVQCHDFARGFQMLGPFTLH
DSRRLIFGDLNAIFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPANYDVDLPFMYSVTY
AAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVVATTVMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDL
NRQRIRRYAQAFQQQDGLYSEDLEKDSGEKLETARPFGAYLSFPTPSVSRSTSRSSTNWERLRQGALRKDLRGIINRGLE
DGEGWEYQI