TCDB is operated by the Saier Lab Bioinformatics Group
>Q9K2Y1|TOLC_VIBCH Outer membrane protein tolC - Vibrio cholerae.
MKKLLPLFVSAALGTLSSAVWAENLAEIYNQAKENDPQLLSVAAQRDAAFEAVTSSRSALLPQINLTAGYNINRSDQAPR
ESDLLSAGINFSQELYQRSSWVSLDTAEKKARQADSQYAATQQGLILRVAKAYFEVLRAQDNLEFVRAEKAAVGRQLEQT
KQRFEVGLSAITDVHDAQAQFDGVLADEVLAENSLTNSYEALREITGQEYSKLAVLDTKRFAASRTTESSEALIEKAQQQ
NLSLLAARISQDVARDNISLASSGHLPSLTLDGGYNYGNNSNDNAKNTSGEEYNDFKIGVNLKVPLYTGGNTTSLTKQAE
FAYVAASQDLEAAYRSVVKDVRAYNNNINASIGALRAYEQAVISAKSALEATEAGFDVGTRTIVDVLDATRRLYDANKNL
SNARYDYILSVLQLRQAIGTLSEQDVMDVNAGLKVAKK