TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9L3M3 Periplasmic binding protein - Rhizobium leguminosarum (biovar viciae).
MKKSLLSAVALTAMLAFSGNAWADVLIAVAGPLTGPNAAFGAQLQKGAEQAAADINAAGGINGEQIKIELGDDVSDPKQG
ISVANKFAADGVKFVIGHFNSGVSIPASEVYAENGILRNHPGRDEPDLHGTGLWNTFRTCGRDDQQGAIAGKYLADHFKD
AKIAVVHDKTPYGQGLADETKKAMNAAGVTEVIYEGINVGDKDFSALIAKMKEAGVSIIYWGGLHTEAGLIIRQAADQGL
KATLVSGDGIVSNELASIAGDAVAGTLNTFGPDPTANPANKELVEKFKAAGFNPEAYTLYSYAAMQTIAGAAKAAGSLDP
EAVAKAMKEKGPFPTVLGDISFDEKGDPKIPGYIMYEWKKVRTASTATSRRHVSFAPLYGT