TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9L3S4 Putative membrane protein - Anabaena sp. (strain PCC 7120).
MKKGGRLILIEVGVVVAIALILILIMPLVLSEFRLNLLGRFLSLAIVALGIDLIWGYTGLLSLGHGIFFGLGGYAIAMYL
KLLKSQRVSYLISWNCMVSRNFLGFGGPFYSFPIAVAAVVIIPGLLAGLLGYLVFRNRIKGVYFSILTQAAIIVFFNFFN
GQQQFFNGTNGLIDFTTLFGATVSDPKTKFIFYTLTVLFLAATYGICRWLTSGRFGRLLIAIRDDESRVRFSGYDPTDFK
TLVFAVSGAIAGIAGAFYTLQSGSVSPRAMDIAFSIEMVIWVAVGGRATLIGAVLGTLLVNYARAFLSEQFAEIWLFFQG
ALFLIVVTVLPDGLVGWLRSQNIPFLKRPQQISTYPSLEEDPEVQHERQNLGN