TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9LH74|MSL5_ARATH Mechanosensitive ion channel protein 5 OS=Arabidopsis thaliana GN=MSL5 PE=2 SV=1
MAAVDSTDRRDFIVNINGQESGAVGATGSSSNAEGGNIWKESSYDFWDGEKGKNDKKGDDEDEDGGSFHFRQRGERRHSS
AELSDPPSKLIGQFLHKQRASGDEISLDVELNMAELQSNTPPRPATASNTPRRGLTTISESSSPVKTKVKADAVRRRQNR
TSLGGSSDEEGRNRDEAEVLKCGSKKPMLSRNKTKSRLQDPPTPTHPAIDKTEMKSGRRSGIFKSGFLGKSPKAGTPGRN
GFEEEEEEDPFLDEDLPEEFKRDKLSFWVFLEWISLVLIVTSLVCSLTIHNLQRKTWWKLDLWKWEVTVLVLICGRLVSS
WIVRIIVFLVEKNFTWRKRVLYFVYGVRKSVQNCLWLGLVLLAWHFLFDKKVERETRSTALRYVTRVLVCLLVALIIWLV
KTILVKVLASSFHMSTYFDRIQESLFTQYVIETLSGPPLMEIQRMEEEEQQVAEDVKSLEKLAGAKLPPALKATVKSFMK
VGKSPGLNRIGSKRGEDGEGIRIDQLKRMNTKNVSAWNMKRLMNIILKGAISTLDQNMQDTTQEDEDATHIRSEYEAKCA
ARKIFHNVTEPGSRYIYLEDFLRFLCEEEAERAMALFEGASESDKISKSCLKNWVVKAFRERRALALTLNDTKTAVDRLH
RIINVVIGIIIIIIWLLILGIATTRFLLVLSSQLLLVAFVFGNSCKTIFEAIIFLFVMHPFDVGDRCEIDGVQLVVEEMN
ILTTVFLRYDNQKIIYPNSVLGTKPIANYYRSPDMGDAVEFCVHIATPPEKITAIKQRILSYVDNKKDYWYPAPMIVFLS
MDDLNSVKIAVWLTHRMNHQDMGERYIRRGLLLEEVGKTCRELDIEYRLYPLNINVRSLPPTANPTSSDRIPPSWMQQRG
P