TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9LJI2|Q9LJI2_ARATH Na/Ca,K-exchanger-like protein OS=Arabidopsis thaliana GN=At3g14070 PE=4 SV=1
MSAVSFLYSSKTPKFRGVFNGICALVLFCFFFDRSELLRNPLLRNASFVNGGSGSTSGGITQFMVIRRNARQIETNGSGN
NSSLSSSSTVLCSGLHKHMGYADQCEFLKANPICSPDGFFDYLSFFYCSCRDFSILGYMMLGVWLVALFYLLGNTAADYF
CCSLEKLSKLLRLPPTVAGVTLLPLGNGAPDVFASIAAFVGTDKGEVGLNSVLGGAVFVTSVVVGIVSLCVADKEVKIDK
NCFIRDLSFFLFSLVSLLVILMVGRVTVRIAIAFVSIYVVYAFLVAANVILRKHAKRFKLEALTPLLPMQGSVFSPSVGE
DMPMNTPLIETETEDGPPRLQSLPQWMWASNVAIYSNHFAKVSVHDEDRPPWGWIDDTAEVESSSCTKFTSLLEIPLTIP
RRLTIPSVEEDTWSKTYAVASVSLAPVLLASLWSSQDDVSLQACGVAYFFSVVIGSTLGFLAYKNTEPDHPPRRFLIPWV
LGGFIMSIVWFYMIANELVALLVTFGEIYGINPSILALTVLAWGNSMGDLVSNIALTMNGGDGVQIALSGCYAGPMFNTL
VGLGMSMLFGAWSKSPDTYMLPEDKSLFYTLGFLVLGLVWAMVILPRNDMQPSRTLGVGLIAIYLIFVTFRLSCAMGFIP
WAA