TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9LPG3|MSL4_ARATH Mechanosensitive ion channel protein 4 OS=Arabidopsis thaliana OX=3702 GN=MSL4 PE=3 SV=1
MAVDSTDQRRDFVVRIDGEDNGDSEKFWRESSINFWHNDKSSKPPGGEEDDGSFDFMRRSSEKSEEPDPPSKLINQFLNK
QKASGDEISLDMEANMPELQKNTVPPLSSTAVSGSASPVTAPVTASYRNGTGDAIRRRQNRVTLSPSVKDGDSSEDEENR
VDGSEVVKCTSNRSTMRTKTLMKMKTRSRLMDPPTPTYPDMVSGRTPRSGNLNPGFSGRNTKPGTPNQGGSKDLEEEEDP
FSEEDLPEGLRKEKICVWVIIEWIFLILIIASLICSLVIPYLRGKTLWDLALWKWEVMVLVLICGRLVSSWIVKLFVYFV
ESNFLWRKKVLYFVYGIRKPVQNCLWLGLVLIAWHFLFDKKVEREMRSTVLKYVTKVLICLLVAVIIWLIKTLLVKVLAS
SFHMSTYFDRIQESLFTQYVIETLSGPPRIEIHIEEEKVANDVKTFEIVGRKLSPLGPKAVSSPPQVTVGSGRLQKSPSR
VGKSPVLSRSGSKKEGGEEGIRIDHLQRMNTKNVSAWKMKKLMNVIKKGTLSTLDEQIQDTTTQEDDKATQIRSEFEAKL
AARKIFQNVAEPGSRYIYMEDFMRFLSEDESERAMDLFEGASECHKISKSCLKNWVVNAFRERRALALTLNDTKTAVNRL
HRIVDVLVSIVILIIWLLILGIATTKFLLVISSQLLLVVFVFGNSCKTIFEAVIFVFVMHPFDVGDRCEIDGVQMIVEEM
NILTTVFLRFDNQKIVYPNSLLGTKPIANYYRSPDMQDAIEFFVHIATPPEKTTALRQRILSYVDNKKDHWHPSPMIVFR
DMCGLNSVKIAMWPTHKMNHQNMGERYVRRGQLLEEIGRLCRELDIEYRLYPLNINVKSLPAATPITSDRIPPSWNQQRS
V