TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9M0Y3|Q9M0Y3_ARATH Putative uncharacterized protein AT4g05120 (Putative equilibrative nucleoside transporter ENT3) OS=Arabidopsis thaliana GN=ENT3 PE=2 SV=1
MADRYENQPPEKLQGKYQAMVVCCILGIGSLVSWNSMLTIADYYYKVFPDYHPSRVLTLVYQPFALGTILILAYHESKIN
TRKRNLIGYILFTISTFLLIVLDLATKGRGGIGPYIGLCAVVASFGLADATVQGGMIGDLSLMCPELVQSFMGGLAVSGA
LTSALRLITKAAFEKTNDGPRKGAMMFLAISTCIELLCVFLYAYVFPKLPIVKYYRRKAASEGSKTVSADLAAAGIQNQS
DLTDDDSKNQRLSNKELLIQNIDYAVNLFLIYVCTLSIFPGFLYENTGQHGLGDWYALVLVAMYNCWDLVGRYTPLVKWL
KIENRKLITIAVLSRYLLIPAFYFTAKYGDQGWMIMLISVLGLTNGHLTVCIMTIAPKGYKGPEQNALGNLLVIFLLGGI
FAGVALDWLWLIGKKNAF