TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9NRP0|OSTC_HUMAN Oligosaccharyltransferase complex subunit OSTC OS=Homo sapiens OX=9606 GN=OSTC PE=1 SV=1
METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVN
GQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG