TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9NUM4|T106B_HUMAN Transmembrane protein 106B OS=Homo sapiens GN=TMEM106B PE=1 SV=2
MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVA
LIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSV
EVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHS
EQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ