TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9R1N3 NBC-LIKE PROTEIN 2 - Rattus norvegicus (Rat).
MEADGAGEQMRPLLTRGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYVGVHVPFSKESRRRHRHRGHKHHHRRRKDKD
SDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELCYRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVA
TLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDDSIRENVREALLKRHHHQNEKRFTSRIPLVRSFA
DIGKKHSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSLLLSHLLPSSRAGTPAGSRCTTPVPTPQNSPPSSPS
LSRLTSRSSQQTQPQAPEVLVSPDRDDIPRVVIHPPEEDIEALKGQEQKNEENTDFTPGILASPQSAPGNLDSSKSGEVK
GNGSGGSRENSTVDFSKVDMNFMRKIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLSGLTEVPVPTRFLFLLLGPAG
KAPQYHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKSVPSQEKRKIPAFPNGS
APVSADPPKEADHHAGPELQRTGRLFGGLILDIKRKAPFFLSDFKDALSLQCLASILFLYCACMSPVITFGGLLGEATEG
RISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCRDYHLSYLSLRTSIGLWTSFLCIVLVATDASSLV
CYITRFTEEAFAALICIIFIYEALEKLFHLGEIYAFNMHNNLDALTSYTCVCAEPSNPSNETVELWERKNVTAASISWAN
LTVSECKTFHGMFVGSACGPHGPYVPDVLFWCVVLFFTTFFLSSFLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVAIDY
LVGIPSPKLHVPEKFEPTDPSRGWIISPLGDNPWWTLLIAAVPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLL
MVAVMLGVCSIMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMGLSVFMTSVLKFIPMPV
LYGVFLYMGVSSLKGIQFFDRIKLFGMPAKHQPDLIYLRYVPLWKVHVFTVVQLTCLVLLWVIKASAAAVVFPMMVLALV
FVRKLMDLCFTKRELSWLDDLMPESKKKKEDDKKKKEKEEAERMLQGDGDTVHLPFERGSLLQIPVKTLKYSPEKPVSVT
INFEDEPSKKYMDAETSL