TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9RLI8|Q9RLI8_PSEAI CzrA protein OS=Pseudomonas aeruginosa GN=czrA PE=4 SV=1
MFERIIQFAIEQRWLVLLAVLGMAGVGIGSYQKLSIDAVPDITNVQVQINTAAPGYSPLEVEQRITYPVETVMAGLPGLQ
ETRSLSRPGISQVTVIFEEGTDIYFARQQVNERLSTAREQLPEDISPTLGPISTGLGEIYLWTVEAEEGATKEDGSAYTP
TDLRTIQDWIIRPQLRNVKGVAEINTIGRYAKQFLIAPDPKKLAAYKLTLGDLQNAVLRNNENVGAGYIERRGEQLLIRA
PGQVKDMDDIRGIIVSNVDGVPIRIRDVAEVGLGKELRTGRATENGREVVLGTVFMLIGENSREVAQAVGQRLEEINRTL
PKGVKAITVYDRTTLVDKAVATVKKNLVEGAALVIAVLFLFLGNIRAALITATIIPLSMLFTFTGMVGNRVSANLMSLGA
LDFGIIVDGAVVIVENAIRRLAHAQAHHGRQLTRAERFHEVFAASREARRALIFGQIIIMVVYLPIFALTGVEGKMFHPM
AFTVVTALLGAMILSVTFVPAAIALFITGKVKEEENFVMRRARLAYEPALRWVLGHRALVVGGALGVILLTALVASRMGS
EFIPSLSEGDFAMQGLRVPGTSLTQSVEMQQTLEKKLMGKFPEIDGFFARTGTAEIASDLMPPNASDSYVMLKPQSQWPD
PKKSREALLEELQAAALEVPGSVYEFSQPIQLRFNELISGVRSDVAVKVFGDDMQVLNDTAEKISKVLQGIDGASEVKVE
QTTGLPVLTVDIDRDKAARFGLNVGDIQDTVATALGGRNAGTLFEGDRRFDIVIRLPETLRADLPALSNLLIPLPPNNLA
RIDFIPLSDVARLDLSPGPNQISRENGKRRIVVSANVRGRDIGSFVLEAQQKLQDGVKIPAGYWTTWGGQFEQLQSAAKR
LQVVVPVALLLVFTLLFAMFNNVKDGLLVFTGIPFALTGGVLALWLRGIPLSISAAVGFIALSGVAVLNGLVMISFIRNL
LQEGRSLDQAVWEGAITRLRPVLMTALVASLGFVPMALATGTGAEVQRPLATVVIGGILSSTMLTLLVLPVLYRWTHGRD
AGPREETPAAG