TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9RLJ0|Q9RLJ0_PSEAI CzrC protein OS=Pseudomonas aeruginosa GN=czrC PE=4 SV=1
MPILRPLAARGNALLATDGTLPGPAGLANEAPVSFNGTSISLEQALERALRTNPELAAVGRETEIASGARQQAGLIPNPD
LSWSVEDTRQANRQTSVSIAQPLELGGKPARGWRWRNAAARSPGPNWKSVAPNCAPRSVRLLRALTAQERVRLAKTSLDL
ARRALQAADRRVKAGSISSVERVRAQVLADNAQLDLSQAELEQQRTYVQLSSTWDEPQPGFAKVGGALDAVPASITRGAF
VRHLDESPTFALAAQEVARGEAQVDLEKRQRIPNLTVSIGSKYDQTARDGRGERVNLIGLSMPLPLFDRNQGNIYAAQSR
ADQARDLQRATLLRLRSEAVQAYDQLRTSEQELALVRRDLLPGAQSALDSMTRGFEMGKFNFLDVLDAQRTLVGVRAQYV
RALDAAAQARVSMERLLGEDIGHLGQ