TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9RQ05 GLYCINE-BETAINE BINDING PERMEASE PROTEIN (OPUABC) - Lactococcus lactis.
MIDLVIGKIPLANWVSSATDWITSTFSSGFDVIQKSGTVLMNGITGALTAVPFWLMIAVVTILAILVSGKKFAFPLFAFI
GLCLIANQGLWSDLMSTITLVLLSSLLSIIIGVPLGIWMAKSELVAKIVQPILDFMQTMPGFVYLIPAVAFFGIGVVPGV
FASVIFALPPTVRMTNLGIRQVSTELVEAADSFGSTARQKLFKLEFPLAKGTIMAGVNQTIMLALSMVVIASMIGAPGLG
RGVLAAVQSADIGKGFVSGISLVILAIIIDRFTQKLNVSPLEKQGNPKLKKWKRWIAIVSLLALIVGAFSGMSFGKKSSD
KKVDLVYMNWDSEVASINVLTQAMEEHSFDVTTTALDNAVAWQTVANSQADGMVSAWLPNTHKTQWKKYGKSVELLGPNL
KGAKVGFVVPSYMNVNSIEDLTNQANKTITGIEPGAGVMAASENTLKSYSNLKDWKLVPSSSGAMTVALGEAIKQHKDIV
ITGWSPHWIFNKYDLKYLADPKGTMGTSENINTIVRKGLKKENPEAYKVLNNFNWTTKDMESVMLDIQNGKTPEAAAKAW
IKDHQKQVDKWFK