TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9RYL4|Q9RYL4_DEIRA Uncharacterized protein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_A0298 PE=4 SV=1
MSRLLLFLGLALLLGGAAARRWLAPVPLRWLSTGLALLFVGAGLSVYQPLRELGLLAPADVLDYLTAVSAGRAALVLLLA
ATLFLVAEVQKLPALILAGLGGWALWGMAGIGHGGVHGDAVRGLHALHAGAMSIWLGGLGALLRVPAPERLAVARRFSPV
AAACVGLLVLTGLGMSLEHIHSLRVLQSTPYGQTLLLKLLAFVGVLGAAFTVRRSLASTGPGRRLSLEVLALVAVLLLTA
RLGGLPLVH