TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9SAH0|Q9SAH0_ARATH F23A5.26 protein OS=Arabidopsis thaliana GN=At1g80900 PE=4 SV=1
MSELKERLLPPRPASAINLRGDAGSRPSPSGRQPLLGVDVLGLKKRGQGLKSWIRVDTSANSQVIEVDKFTMMRRCDLPA
RDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVLLLNSLDNYVLRYVVELQQRLKASSVTEVWNQDSLELSRRR
SRSLDNVLQNSSPDYLPFEFRALEVALEAACTFLDSQASELEIEAYPLLDELTSKISTLNLERARRLKSRLVALTRRVQK
VRDEIEQLMDDDGDMAEMYLTEKKKRMEGSLYGDQSLPVYRTNDCFSLSAPVSPVSSPPESRRLEKSLSIVRSRHDSARS
SEDATENIEELEMLLEAYFVVIDSTLNKLTSLKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGM
NFEIDFFEKPGAFKWVLAITGVCGLVVFLAFLWYYKRRRLMPL