TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9SGN6|NSL1_ARATH MACPF domain-containing protein NSL1 OS=Arabidopsis thaliana GN=NSL1 PE=2 SV=1
MAFNNFTRLDAHSAAEKAVSVIGLGYDLCSDVRFSACKTTPDGSRLVEIDPTRNRDLIFPGGIVVNNVSSSIKCDKGERT
RLRSDILSFNQMSEKFNQDMCLSGKIPSGMFNNMFAFSKCWPKDASSVKTLAYDGWFISLYSVEIVRKQLTLRDEVKREV
PSSWDSAALAGFIEKYGTHVVVGVTMGGKDVIHVKQMRKSNHEPEEIQKMLKHWGDERFCVDPVESKSPASVYSGKPKEE
NLLQWGLQPFGTSVSSAVVMHTKNEEIMRVCIRRGGVDLGQSHERWLSTVSQAPNVISMCFVPITSLLSGLPGTGFLSHA
VNLYLRYKPPIEELHQFLEFQLPRQWAPVYGDLPLGLRRSKQSSPSLQFSLMGPKLYVNTSKVDSGERPVTGLRFFLEGK
KGNHLAIHLQHLSACPPSLHLSHDDTYEPIEEPVEKGYYVPVKWGIFSHVCTYPVQYNGARSDDTASIVTKAWLEVKGMG
MRKVLFLRLGFSLDASAVTRKSCWDNLSTNSRKSGVFSMISTRLSTGLSPNPATTKPQSKIDINSAVYPRGPSPPVKPKL
LSLVDTKEVMRGPEEQPGYWVVTGAKLCVEAGKISIKAKYSLLTVISEDSLV