TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9SY14|Q9SY14_ARATH ERD (Early-responsive to dehydration stress) family protein OS=Arabidopsis thaliana GN=T5J8.22 PE=4 SV=1
MASVQDIGLSAAINLLSAFAFLFAFAMLRLQPVNDRVYFPKWYLKGIRGSPTRSRGIMTRFVNLDWTTYVKFLNWMPAAL
QMPEPELIEHAGLDSAVYIRIYLLGLKMFVPITLLAFGVLVPVNWTGETLENIDDLTFSNVDKLSISNVPPGSPRFWAHI
TMTYVITFWTCYILYMEYKAVANMRLRHLAAESRRPDQLTVLVRNVPPDPDESVNEHVEHFFCVNHPDHYLCHQVVYNAN
DLAKLVAQRKAMQNWLTYYENKFERKPSSRPTTKTGYGGFWGTTVDAIDFYTSKMDILAEQEAVEREKIMNDPKAIMPAA
FVSFRSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIRRLLTTVALFFLIFCFMIPIAFVQSLANLE
GIQKVLPFLKPVIEMKTVKSVIQGFLPGIALKIFLIILPTILMTMSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIIT
GTAFQQLKSFLEQPPTEIPKTVGVSIPMKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQAMDPGH
LDFATSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFAYVVFRHQVINVYDQKYESGARYWPDVHRRLIICLIISQLLMM
GLLSTKKFAKVTALLLPQPILTFWFYRYCAGRFESAFSKFPLQEAMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGNDFD
RPRVVDEEESNPLVRTKRTSQGTTRYNSEASSSATTTPVANNDSPRCWGTKIGSFGCVIVVSYSC