TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9UMX3|BOK_HUMAN Bcl-2-related ovarian killer protein OS=Homo sapiens OX=9606 GN=BOK PE=1 SV=1
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMI
RPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT
LATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER