TCDB is operated by the Saier Lab Bioinformatics Group
>Q9UY73|Q9UY73_PYRAB Membrane protein, putative - Pyrococcus abyssi.
MDKMIRLAMEFYKNELSDSVLYAELAKYEKDEKVREEFLRLSRIEAQHAKFWERFLEKRGVKPEKPSVGKIKRFSVRLLR
RLLGPGLTVSFLEMGENNAINSYFNFLVSNAKAFDEEEVKALKMIIFEELEHEKFFSEAKKRFHVENLRDFVLGMNDGLV
EILGAVTGLSAVYPNLPRLVGISGLIVGVAGALSMAIGALISVRSQRQVSESIRNRTKIIFQVSPERAVQEIYERLREGG
LPEDIAREVSEKLSQRGEAVIKLLVPEEDENEFRAALYTGVAYLFGVMFPITPYFLASSSLTALPLSVTLAGLALAIVAT
SISLISGISIRKKVAEMVVTGLGAAFLSYLFGHLMESIFHVSAL