TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9V8Y7|OR56A_DROME Putative odorant receptor 56a OS=Drosophila melanogaster GN=Or56a PE=1 SV=2
MFKVKDLLLSPTTFEDPIFGTHLRYFQWYGYVASKDQNRPLLSLIRCTILTASIWLSCALMLARVFRGYENLNDGATSYA
TAVQYFAVSIAMFNAYVQRDKVISLLRVAHSDIQNLMHEADNREMELLVATQAYTRTITLLIWIPSVIAGLMAYSDCIYR
SLFLPKSVFNVPAVRRGEEHPILLFQLFPFGELCDNFVVGYLGPWYALGLGITAIPLWHTFITCLMKYVNLKLQILNKRV
EEMDITRLNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLICVPVMADFIIFSVLICFLFFALTVGVPSK
MDYFFMFIYLFVMAGILWIYHWHATLIVECHDELSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRALLVDLNLRTFI
DIGRGAYSYFNLLRSSHLY