TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9VKA4|Y1760_DROME Probable G-protein coupled receptor CG31760 OS=Drosophila melanogaster GN=CG31760 PE=1 SV=2
MKCWHNVVRRRRKKPTAAAAAKGSKGSHGGVASPRDEDAICQRQQQVDTYTWLTTQAVPLLWLHLLLLVAFAKHAAAATT
IATNPEATTTTVSNYTVTTTALSSSTTTTSSGSAPALSSAADKFAGNWANLEDSFRNIVRIGDGNTVTRTSIEQSLVTIH
DIATENLGTLCISTLYRPLQVPINSERYESSRQKTDLAASILQEVGIIRHGGLSDALAKGLLTDDFITGARILALNLTNG
AVQSYVWWVKGTAAEIQRYDEDGLQIGKKPAGSYPWFDDETSSPTLRSPKFAPSPPNNYYKGWWTYPYFSCSQSRWLVSY
SIAIPPIGRHGLRGFISIDIDVSTLRVNQCEAEPYPFGSRRQKMQQLQTHNRLGARRSLFLGSRMGAIDESTINDLQAFH
SSHKCHRTSMVCDYRQPSAETPTVTGGKLLTTLTGSSSWTRGSYQCLCRGGFYSLRHPDGFNGTIMEIAWQEQQDNISNY
YSEVFKCLPCAPGCDTCTGPEPCLANYHWPFRISLLTISIGCACGTFVLAGYLFRHRRVKVFKVASPIFLMITLIGCAIM
YLEMVAIFPYLDTTWCIATKWTRHMGFCITYTSLLMKTWRVSLTYRVKSAHKIKLNDQQLLQWMVPILLVMLIYLGTWTI
SATPTAEVILDQSQLKFKQCSYNWWDHSLAIGEVFFLAWGIRVCYNVRNAESLYNEARLISYAIYNIALVNIAMVVFHVM
LFPNAGPDYKYMLGFVRTQLSTTTTIALVFGPKILRVFKGQGDKWDQKAKVRSITASFSLNGVGLVPEESPDLYQENEEL
KEQVQKLAHQIEFMKTVHMQMNNRHLKPKPGGYFTITSTSFQAPYSKNTVSTAQTQTGKDENSVKDCSIEIDGGQGRTTL
VEDAIEFNFHLADTEKGLIVQEDERPGSDEEEAALIAQFRRLFAPILDDSLNLYYQLNDLDDTEHVRIHQTVAQMNDLTS
SEEETMVTQVNSPSPPPVGVELLLPISSDSSTASSSLYAIHTPSPAHPSGVLLMPQNLESPLLSGSDAITITEQVELHNP
PHHLQLLEDENNTSCSLSSNLTDSKTLDGRTPIVV