TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9VL24|Q9VL24_DROME Niemann-Pick type C-1a, isoform A OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=1 SV=2
MSPRSPLRISPFGVHILIAAVLFTLIQSSKQDCVWYGVCNTNDFSHSQNCPYNGTAKEMATDGLELLKKRCGFLLENSEN
KFCCDKNQVELLNKNVELAGNILDRCPSCMENLVRHICQFTCSPKQAEFMHVVATQKNKKGDEYISSVDLHISTEYINKT
YKSCSQVSVPQTGQLAFDLMCGAYSASRCNPTKWFNFMGDATNPYVPFQITYIQHEPKSNSNNFTPLNVTTVPCNQAVSS
KLPACSCSDCDLSCPQGPPEPPRPEPFKIVGLDAYFVIMAAVFLVGVLVFLMGSFLFTQGSSMDDNFQVDGNDVSDEMPY
SENDSYFEKLGAHTETFLETFFTKWGTYFASNPGLTLIAGASLVVILGYGINFIEITTDPVKLWASPNSKSRLEREFFDT
KFSPFYRLEQIIIKAVNLPQIVHNTSNGPYTFGPVFDREFLTKVLDLQEGIKEINANGTQLKDICYAPLSDDGSEIDVSQ
CVVQSIWGYFGDDRERLDDHDEDNGFNVTYLDALYDCISNPYLCLAPYGGPVDPAIALGGFLPPGDQLTGSTKFELANAI
ILTFLVKNHHNKTDLENALTWEKKFVEFMTNYTKNNMSQYMDIAFTSERSIEDELNRESQSDVLTILVSYLIMFMYIAIS
LGHVKEFKRVFIDSKITLGIGGVIIVLASVVSSVGVFGYIGLPATLIIVEVIPFLVLAVGVDNIFILVQTHQRDQRKPNE
TLEQQVGRILGKVGPSMLLTSLSESFCFFLGGLSDMPAVRAFALYAGVALIIDFLLQITCFVSLFTLDTKRREENRMDIC
CFIKGKKPDSITSNEGLLYKFFSSVYVPFLMKKIVRASVMVIFFAWLCFSIAIAPRIDIGLDQELAMPQDSFVLHYFQSL
NENLNIGPPVYFVLKGDLAYTNSSDQNLVCAGQYCNDDSVLTQIYLASRHSNQTYIARPASSWIDDYFDWAAAASSCCKY
RKDSGDFCPHQDTSCLRCNITKNSLLRPEEKEFVKYLPFFLKDNPDDTCAKAGHAAYGGAVRYSNSHERLNIEASYFMAY
HTILKSSADYFLALESARKISANITQMLQGRLMSNGVPMASALTVEVFPYSVFYVFYEQYLTMWSDTLQSMGISVLSIFV
VTFVLMGFDVHSALVVVITITMIVVNLGGLMYYWNISLNAVSLVNLVMAVGISVEFCSHLVHSFATSKSVSQIDRAADSL
SKMGSSIFSGITLTKFAGILVLAFAKSQIFQVFYFRMYLGIVVIGAAHGLIFLPVLLSYIGAPVSNARLRYHSQAAAEHE
TALAGIL