TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9VM08|GR28B_DROME Putative gustatory receptor 28b OS=Drosophila melanogaster GN=Gr28b PE=1 SV=2
MDIEMAKEPVNPTDTPDIEVTPGLCQPLRRRFRRFVTAKQLYECLRPVFHVTYIHGLTSFYISCDTKTGKKAIKKTIFGY
INGIMHIAMFVFAYSLTIYNNCESVASYFFRSRITYFGDLMQIVSGFIGVTVIYLTAFVPNHRLERCLQKFHTMDVQLQT
VGVKIMYSKVLRFSYMVLISMFLVNVLFTGGTFSVLYSSEVAPTMALHFTFLIQHTVIAIAIALFSCFTYLVEMRLVMVN
KVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSMYTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLI
IVFDAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSAEVKEKLQ
QFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL