TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9VPI2|IR21A_DROME Ionotropic receptor 21a OS=Drosophila melanogaster OX=7227 GN=Ir21a PE=2 SV=2
MSYYWVALVLFTAQAFSIEGDRSASYQEKCISRRLINHYQLNKEIFGVGMCDGNNENEFRQKRRIVPTFQGNPRPRGELL
ASKFHVNSYNFEQTNSLVGLVNKIAQEYLNKCPPVIYYDSFVEKSDGLILENLFKTIPITFYHGEINADYEAKNKRFTSH
IDCNCKSYILFLSDPLMTRKILGPQTESRVVLVSRSTQWRLRDFLSSELSSNIVNLLVIGESLMADPMRERPYVLYTHKL
YADGLGSNTPVVLTSWIKGALSRPHINLFPSKFQFGFAGHRFQISAANQPPFIFRIRTLDSSGMGQLRWDGVEFRLLTMI
SKRLNFSIDITETPTRSNTRGVVDTIQEQIIERTVDIGMSGIYITQERLMDSAMSVGHSPDCAAFITLASKALPKYRAIM
GPFQWPVWVALICVYLGGIFPIVFTDRLTLSHLMGNWGEVENMFWYVFGMFTNAFSFTGKYSWSNTRKNSTRLLIGAYWL
FTIIITSCYTGSIIAFVTLPAFPDTVDSVLDLLGLFFRVGTLNNGGWETWFQNSTHIPTSRLYKKMEFVGSVDEGIGNVT
QSFFWNYAFLGSKAQLEYLVQSNFSDENISRRSALHLSEECFALFQIGFLFPRESVYKIKIDSMILLAQQSGLIAKINNE
VSWVMQRSSSGRLLQASSSNSLREIIQEERQLTTADTEGMFLLMALGYFLGATALVSEIVGGITNKCRQIIKRSRKSAAS
SWSSASSGSMLRTNAEQLSHDKRKANRREAAEVAQKMSFGMRELNLTRATLREIYGSYGAPETDHGQLDIVHTEFPNSSA
KLNNIEDEESREALESLQRLDEFMDQMDNDGNPSSHTFRIDN