TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9VWV9|PORCN_DROME Protein-serine O-palmitoleoyltransferase porcupine OS=Drosophila melanogaster OX=7227 GN=por PE=1 SV=1
MDYQYFEEESDYIDLDEEEEDDDVVTAGSLDHRFGQPNGEEDYYFGGDDVEEELVVDGHGVLELAGRLLESLQSCVQPSV
LQVMQYVAPMLLLCLLCRLLCLLYSQRRRLTSLAPLHLFHFACGLIILQITVGYRLLLLLLLAAVGYLLLQLLRLGRRGA
QVLAVLTVGSQFLYELLIWRRRSDWPQLRGIQMVVNMKLISLGFDLTASGQLQARIPGPFAYLGYIYSPATCALGPWVSF
GCYMDCLVPRNSWLVSLRRLLPNVVICVLAVTVSNCVAPALSDFFGDSSHFLVMYWDALSVRSSHYFVGMMAQALLVASD
QRLDGATKESDMLGPLISQPWRIEWPRSISSLVRSWNIPMHEWLKRYIYAPCKPTASTSRGRILVVVLSTYLVSSLLHGM
DLRIYLVLISLAFLAEGESLLRRQLASLLNACITANLCPGKERCRYSHCPSKRRLNSLSYWLARLTNLAFTALAIFHLAY
LGVVLLGDDLEVGEDGDSFLWHWQQAGYLSHYIGLGTFVLYLFIS