TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9WVC8 DOWN-REGULATED IN ADENOMA PROTEIN - Mus musculus (Mouse).
MIEAIGNQYVVARPVYSTKTFGEEFKKTHRHHKTFLDHLKGCCSCSSQKAKKIALSLFPIASWLPAYKIKEWLLSDIVSG
ISTGLVAVLQGLAFALLVNIPPAYGLYAAFFPVITYFFLGTSRHISVGPFPVLSMMVGVVVTRVVSDPNASSELSSSSTE
NDSFIEEKVMVAASVTVLSGIIQLLLGVLQVGFVVIYLSESLISGFTTAAAIHVLVSQLKFMLQLPVPAYSDPFSIFKVL
ESVFTQIQKTNIADLVTSVIILVVVFVFKEINQRYRSKLPVPIPIELIMTVIATGVSYGCNFEDRFGVAVVGNMSLGFQP
PITPSVEVFQDTIGDSFGIAIVGFAVAFSVASVYSLKYDYPIDGNQELIALGVSNIFTGAFKGFAGSTALSRSGVQESTG
GKTQVAGLLSAVIVLIVIVAIGFLLQPLQKSVLAALALGNLKGMLMQFAEIGRLWKKDKYDCLIWIMTFIFAIVLGLGLG
LAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKNYAEVYEPEGVKIFRCPSPIYFANIGFFKQKLIDAVGFSPLRI
LRKRNKALKKIRKLQKRGLIQMTPKGFICTSDGFKDSDEELDNNQIEELDQPINTTDLPFDIDWNGDLPLNITIPKISLH
SLILDFSAVSFLDVSSMRGLRTILQEFIRIKVDVYIVGTDDDFIDKLARCEFFDDEVTDSIFFLTIHDAILHILMKKDYS
TSKFNSSQEKERKFDFTINTNGGLRNRECQVPVETKF