TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9WXR2|Q9WXR2_THEMA Oligopeptide ABC transporter, periplasmic oligopeptide-binding protein, putative OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0056 PE=4 SV=1
MLVVRRLFVLLSLVFMVVLALAANDTWVFYATPEEYYKATGKKITEYHESPMLTKLVEEGKLPPVEQRLPEEPLVVQPVE
KVGQFGGTWRRVWKGPSDRWGISKLIEVKLAFWDKEGGKLVPGLAKSWEVLENGRVYIFHLRKGVKWSDGAPYTAHDIVF
WVNDIVGNDDITPSKPDWYNIGVKVEALDDYTVKFEFSKPYGLFLLKVPYGGFTGAPAHYLKQFHPKYTPMEEIEKKMVE
GVHNTWVDLFNDKNDFLENTELPTLSPWKPITDPTEQFYILERNPYFWAVDIEGNQLPYIDYVRHEYVKNDEVILLKAIS
GEIDMQWRHIGGLGAGAGNFTLLMENSQSGGYRVLKWIAANGSASRISLNYAHSDEVLRKVFNDVRFRQALSLAINREEI
NEILFNGLAEPRQASLVSGSPYFDPEWEKAYAEYDPDRANKLLDEMGLKWDDKHEYRLLPDGRPLRFTITVTGQFHVDVW
TMVKEYWKQIGVWVEIENLERSLFYERADAGDFDAMVWNMDRAAQPLSSPMVIFPGSENIADFWYIGWSGWISYYIDKNI
RGVEPEEVPEGPEPPEVVYRLVDLYYQIASTPDPDKIKELMAEATKIHRENLWMIGTVGEDLSPAIAKNNFRNVPEFLVT
DDVLRTPLNAMPMQFFIEQK